General Information

  • ID:  hor006100
  • Uniprot ID:  P01172
  • Protein name:  Somatostatin-22
  • Gene name:  sst2
  • Organism:  Ictalurus punctatus (Channel catfish) (Silurus punctatus)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  Pancreas.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Ictalurus (genus), Ictaluridae (family), Siluroidei (suborder), Siluriformes (order), Characiphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DNTVTSKPLNCMNYFWKSRTAC
  • Length:  22(84-105)
  • Propeptide:  MSSSPLRLALALMCLVSAVGVISCGRPHVVLNSALEEARNVPFGEEVPERLTLPELQWMLSNNELTPVQVEEAPRSRLELVRRDNTVTSKPLNCMNYFWKSRTAC
  • Signal peptide:  MSSSPLRLALALMCLVSAVGVISC
  • Modification:  NA
  • Glycosylation:  T5 O-linked (GalNAc...) threonine
  • Mutagenesis:  NA

Activity

  • Function:  Somatostatin inhibits the release of somatotropin.
  • Mechanism:  Biological activity of somatostatin-22 on rat pituitary cells was found to be only 0.01-0.1% of somatostatin-14 activity.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45983
  • Structure ID:  AF-P01172-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006100_AF2.pdbhor006100_ESM.pdb

Physical Information

Mass: 295469 Formula: C111H171N31O34S3
Absent amino acids: EGHIQ Common amino acids: NT
pI: 8.79 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 5
Hydrophobicity: -65 Boman Index: -4832
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 35.45
Instability Index: 4063.64 Extinction Coefficient cystines: 7115
Absorbance 280nm: 338.81

Literature

  • PubMed ID:  2863931
  • Title:  Somatostatins of the channel catfish.
  • PubMed ID:  6127673
  • Title:  Sequence of a cDNA encoding pancreatic preprosomatostatin-22.
  • PubMed ID:  6149220
  • Title:  Structure of the 22-residue somatostatin from catfish. An O-glycosylated peptide having multiple forms.
  • PubMed ID:  7358665
  • Title:  Amino acid sequence of catfish pancreatic somato